Seladin 1 Antikörper (N-Term)

Produktnummer ABIN634838

Produktdetails anti-Seladin 1 Antikörper

Target: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Seladin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DHCR24 antibody was raised against the N terminal of DHCR24

Aufreinigung: Affinity purified

Immunogen: DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHCR24 Blocking Peptide, catalog no. 33R-2970, is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Seladin 1

Target: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Andere Bezeichnung: DHCR24 (DHCR24 Produkte)

Synonyme: MGC82737 antikoerper, zgc:101638 antikoerper, DCE antikoerper, Nbla03646 antikoerper, SELADIN1 antikoerper, seladin-1 antikoerper, 2310076D10Rik antikoerper, 5830417J06Rik antikoerper, mKIAA0018 antikoerper, 24-dehydrocholesterol reductase antikoerper, 24-dehydrocholesterol reductase S homeolog antikoerper, delta(24)-sterol reductase antikoerper, DHCR24 antikoerper, dhcr24.S antikoerper, dhcr24 antikoerper, LOC5575872 antikoerper, CpipJ_CPIJ000670 antikoerper, Dhcr24 antikoerper

Hintergrund: DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells.

Molekulargewicht: 58 kDa (MW of target protein)