STEAP4 Antikörper (STEAP Family Member 4) (C-Term)

Details for Product anti-STEAP4 Antibody No. ABIN635483
Antigen
Epitop
C-Term
11
9
6
5
4
3
2
1
1
1
1
Reaktivität
Human
77
17
12
2
2
2
1
Wirt
Kaninchen
68
7
2
Klonalität
Polyklonal
Konjugat
Dieser STEAP4 Antikörper ist unkonjugiert
4
2
2
2
2
2
2
2
2
2
1
1
1
Applikation
Western Blotting (WB)
37
35
31
17
13
8
6
5
3
2
2
1
Optionen
Immunogen STEAP4 antibody was raised using the C terminal of STEAP4 corresponding to a region with amino acids AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA
Spezifität STEAP4 antibody was raised against the C terminal of STEAP4
Reinigung Affinity purified
Antigen
Andere Bezeichnung STEAP4 (STEAP4 Antibody Abstract)
Hintergrund Metalloreductase has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). It uses NAD(+) as acceptor.
Molekulargewicht 52 kDa (MW of target protein)
Pathways Transition Metal Ion Homeostasis
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

STEAP4 Blocking Peptide, catalog no. 33R-1165, is also available for use as a blocking control in assays to test for specificity of this STEAP4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-STEAP Family Member 4 (STEAP4) (C-Term) antibody (ABIN635483) STEAP4 antibody used at 1 ug/ml to detect target protein.