MGC4172 (Middle Region) Antikörper

Produktnummer ABIN635482

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MGC4172 (Middle Region) Antikörper (ABIN635482)

Target: MGC4172

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: Middle Region

Spezifität: MGC4172 antibody was raised against the middle region of MGC4172

Aufreinigung: Affinity purified

Immunogen: MGC4172 antibody was raised using the middle region of MGC4172 corresponding to a region with amino acids DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC4172 Blocking Peptide, (ABIN937337), is also available for use as a blocking control in assays to test for specificity of this MGC4172 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC4172 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: MGC4172

Hintergrund: The function of MGC4172 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 28 kDa (MW of target protein)