MGC4172 (C-Term) Antikörper

Produktnummer ABIN635565

Produktdetails

Target: MGC4172

Bindungsspezifität: C-Term

Reaktivität: Maus, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MGC4172 antibody was raised against the C terminal of MGC4172

Aufreinigung: Affinity purified

Immunogen: MGC4172 antibody was raised using the C terminal of MGC4172 corresponding to a region with amino acids VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC4172 Blocking Peptide, catalog no. 33R-9515, is also available for use as a blocking control in assays to test for specificity of this MGC4172 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC4172 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: MGC4172

Hintergrund: MGC4172 possesses oxidoreductase activity.

Molekulargewicht: 19 kDa (MW of target protein)