LRRC8B Antikörper (N-Term)

Produktnummer ABIN635448

Produktdetails anti-LRRC8B Antikörper

Target: LRRC8B (Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC8B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC8 B antibody was raised against the N terminal of LRRC8

Aufreinigung: Affinity purified

Immunogen: LRRC8 B antibody was raised using the N terminal of LRRC8 corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC8B Blocking Peptide, catalog no. 33R-7375, is also available for use as a blocking control in assays to test for specificity of this LRRC8B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC8B

Target: LRRC8B (Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B))

Andere Bezeichnung: LRRC8B (LRRC8B Produkte)

Synonyme: TA-LRRP antikoerper, TALRRP antikoerper, R75581 antikoerper, Ta-lrrp antikoerper, mKIAA0231 antikoerper, RGD1563429 antikoerper, leucine rich repeat containing 8 family member B antikoerper, leucine rich repeat containing 8 VRAC subunit B S homeolog antikoerper, leucine rich repeat containing 8 VRAC subunit B antikoerper, leucine rich repeat containing 8 family, member B antikoerper, LRRC8B antikoerper, lrrc8b.S antikoerper, lrrc8b antikoerper, Lrrc8b antikoerper

Hintergrund: The function of LRRC8B protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 92 kDa (MW of target protein)