EDEM1 Antikörper (N-Term)

Produktnummer ABIN635444

Produktdetails anti-EDEM1 Antikörper

Target: EDEM1 (ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EDEM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EDEM1 antibody was raised against the N terminal of EDEM1

Aufreinigung: Affinity purified

Immunogen: EDEM1 antibody was raised using the N terminal of EDEM1 corresponding to a region with amino acids MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EDEM1 Blocking Peptide, catalog no. 33R-5674, is also available for use as a blocking control in assays to test for specificity of this EDEM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDEM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EDEM1

Target: EDEM1 (ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1))

Andere Bezeichnung: EDEM1 (EDEM1 Produkte)

Synonyme: zgc:55816 antikoerper, edem antikoerper, EDEM1 antikoerper, EDEM antikoerper, A130059K23Rik antikoerper, mKIAA0212 antikoerper, RGD1563633 antikoerper, ER degradation enhancer, mannosidase alpha-like 1 antikoerper, ER degradation enhancing alpha-mannosidase like protein 1 antikoerper, ER degradation-enhancing alpha-mannosidase-like protein 1 antikoerper, ER degradation enhancing alpha-mannosidase like protein 1 L homeolog antikoerper, edem1 antikoerper, EDEM1 antikoerper, LOC100637820 antikoerper, edem1.L antikoerper, Edem1 antikoerper

Hintergrund: EDEM1 belongs to the glycosyl hydrolase 47 family. It extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner.

Molekulargewicht: 74 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling