TRAM2 Antikörper (Translocation Associated Membrane Protein 2) (N-Term)

Details for Product anti-TRAM2 Antibody No. ABIN635438
Antigen
Epitop
N-Term
15
10
7
4
2
2
1
1
1
Reaktivität
Human, Maus
45
19
15
4
4
3
3
3
2
2
2
1
1
Wirt
Kaninchen
44
3
Klonalität
Polyklonal
Konjugat
Dieser TRAM2 Antikörper ist unkonjugiert
4
3
3
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
38
28
22
4
1
1
Optionen
Immunogen TRAM2 antibody was raised using the N terminal of TRAM2 corresponding to a region with amino acids MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII
Spezifität TRAM2 antibody was raised against the N terminal of TRAM2
Reinigung Affinity purified
Antigen
Andere Bezeichnung TRAM2 (TRAM2 Antibody Abstract)
Hintergrund TRAM2 is a component of the translocon, a gated macromolecular channel that controls the posttranslational processing of nascent secretory and membrane proteins at the endoplasmic reticulum (ER) membrane.
Molekulargewicht 43 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TRAM2 Blocking Peptide, catalog no. 33R-5990, is also available for use as a blocking control in assays to test for specificity of this TRAM2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAM2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Translocation Associated Membrane Protein 2 (TRAM2) (N-Term) antibody (ABIN635438) TRAM2 antibody used at 1 ug/ml to detect target protein.