TRAM2 Antikörper (N-Term)

Produktnummer ABIN635438

Produktdetails anti-TRAM2 Antikörper

Target: TRAM2 (Translocation Associated Membrane Protein 2 (TRAM2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRAM2 antibody was raised against the N terminal of TRAM2

Aufreinigung: Affinity purified

Immunogen: TRAM2 antibody was raised using the N terminal of TRAM2 corresponding to a region with amino acids MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAM2 Blocking Peptide, catalog no. 33R-5990, is also available for use as a blocking control in assays to test for specificity of this TRAM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAM2

Target: TRAM2 (Translocation Associated Membrane Protein 2 (TRAM2))

Andere Bezeichnung: TRAM2 (TRAM2 Produkte)

Synonyme: C330003D03Rik antikoerper, wu:fb20c11 antikoerper, wu:fi23a12 antikoerper, zgc:111902 antikoerper, zgc:55869 antikoerper, zgc:76937 antikoerper, tram2 antikoerper, translocation associated membrane protein 2 antikoerper, tram-like protein antikoerper, TraM-like protein antikoerper, translocating chain-associating membrane protein 2 antikoerper, translocation associated membrane protein 2 L homeolog antikoerper, TRAM2 antikoerper, CJE0444 antikoerper, BT_p548215 antikoerper, traM antikoerper, CJJ81176_0418 antikoerper, Tram2 antikoerper, tram2 antikoerper, tram2.L antikoerper

Hintergrund: TRAM2 is a component of the translocon, a gated macromolecular channel that controls the posttranslational processing of nascent secretory and membrane proteins at the endoplasmic reticulum (ER) membrane.

Molekulargewicht: 43 kDa (MW of target protein)