TRAM2 Antikörper (N-Term)

Produktnummer ABIN635438

Der Kaninchen Polyklonal Anti-TRAM2 Antikörper wurde für WB validiert. Er ist geeignet, TRAM2 in Proben von Human und Maus zu detektieren.

Kurzübersicht für TRAM2 Antikörper (N-Term) (ABIN635438)

Target: TRAM2 (Translocation Associated Membrane Protein 2 (TRAM2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRAM2 Antikörper

Bindungsspezifität: N-Term

Spezifität: TRAM2 antibody was raised against the N terminal of TRAM2

Aufreinigung: Affinity purified

Immunogen: TRAM2 antibody was raised using the N terminal of TRAM2 corresponding to a region with amino acids MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAM2 Blocking Peptide, (ABIN5616755), is also available for use as a blocking control in assays to test for specificity of this TRAM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAM2

Target: TRAM2 (Translocation Associated Membrane Protein 2 (TRAM2))

Andere Bezeichnung: TRAM2

Hintergrund: TRAM2 is a component of the translocon, a gated macromolecular channel that controls the posttranslational processing of nascent secretory and membrane proteins at the endoplasmic reticulum (ER) membrane.

Molekulargewicht: 43 kDa (MW of target protein)