Podoplanin Antikörper (Middle Region)

Produktnummer ABIN635390

Der Kaninchen Polyklonal anti-Podoplanin Antikörper wird verwendet zum Nachweis von Podoplanin in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Podoplanin Antikörper (Middle Region) (ABIN635390)

Target: Podoplanin (PDPN)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Podoplanin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Podoplanin Antikörper

Bindungsspezifität: Middle Region

Spezifität: Podoplanin antibody was raised against the middle region of PDPN

Aufreinigung: Affinity purified

Immunogen: Podoplanin antibody was raised using the middle region of PDPN corresponding to a region with amino acids VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Podoplanin Blocking Peptide, (ABIN5615446), is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDPN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Podoplanin

Target: Podoplanin (PDPN)

Andere Bezeichnung: Podoplanin

Hintergrund: PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport