Podoplanin Antikörper (N-Term)
Kurzübersicht für Podoplanin Antikörper (N-Term) (ABIN635389)
Target
Alle Podoplanin (PDPN) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- Podoplanin antibody was raised against the N terminal of PDPN
-
Aufreinigung
- Affinity purified
-
Immunogen
- Podoplanin antibody was raised using the N terminal of PDPN corresponding to a region with amino acids EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT
-
-
-
-
Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
Podoplanin Blocking Peptide, (ABIN937806), is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDPN antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- Podoplanin (PDPN)
-
Andere Bezeichnung
- Podoplanin
-
Hintergrund
- PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.
-
Molekulargewicht
- 25 kDa (MW of target protein)
-
Pathways
- Dicarboxylic Acid Transport
Target
-