Podoplanin Antikörper (N-Term)

Produktnummer ABIN635389

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Podoplanin in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Podoplanin Antikörper (N-Term) (ABIN635389)

Target: Podoplanin (PDPN)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Podoplanin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Podoplanin Antikörper

Bindungsspezifität: N-Term

Spezifität: Podoplanin antibody was raised against the N terminal of PDPN

Aufreinigung: Affinity purified

Immunogen: Podoplanin antibody was raised using the N terminal of PDPN corresponding to a region with amino acids EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Podoplanin Blocking Peptide, (ABIN937806), is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDPN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Podoplanin

Target: Podoplanin (PDPN)

Andere Bezeichnung: Podoplanin

Hintergrund: PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport