C19orf28 Antikörper (Chromosome 19 Open Reading Frame 28) (Middle Region)

Details for Product anti-C19orf28 Antibody No. ABIN635358
Antigen
Epitop
Middle Region
5
1
Reaktivität
Human
22
1
1
Wirt
Kaninchen
22
Klonalität
Polyklonal
Konjugat
Dieser C19orf28 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
13
10
3
2
1
Optionen
Immunogen C19 ORF28 antibody was raised using the middle region of C19 rf28 corresponding to a region with amino acids VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD
Spezifität C19 ORF28 antibody was raised against the middle region of C19 rf28
Reinigung Affinity purified
Antigen
Andere Bezeichnung C19ORF28
Hintergrund The function of this gene remains unknown.
Molekulargewicht 51 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

C19ORF28 Blocking Peptide, catalog no. 33R-9502, is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Chromosome 19 Open Reading Frame 28 (C19orf28) (Middle Region) antibody (ABIN635358) C19ORF28 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml t...
Image no. 2 for anti-Chromosome 19 Open Reading Frame 28 (C19orf28) (Middle Region) antibody (ABIN635358) C19ORF28 antibody used at 0.5 ug/ml to detect target protein.