C19orf28 Antikörper (Middle Region)
-
- Target Alle C19orf28 Produkte
- C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))
- Bindungsspezifität
- Middle Region
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C19orf28 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- C19 ORF28 antibody was raised against the middle region of C19 rf28
- Aufreinigung
- Affinity purified
- Immunogen
- C19 ORF28 antibody was raised using the middle region of C19 rf28 corresponding to a region with amino acids VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C19ORF28 Blocking Peptide, catalog no. 33R-9502, is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))
- Andere Bezeichnung
- C19ORF28 (C19orf28 Produkte)
- Synonyme
- MGC81076 antikoerper, C19orf28 antikoerper, PP3501 antikoerper, F630110N24Rik antikoerper, Wdt1 antikoerper, major facilitator superfamily domain containing 12 L homeolog antikoerper, major facilitator superfamily domain containing 12 antikoerper, mfsd12.L antikoerper, mfsd12 antikoerper, MFSD12 antikoerper, Mfsd12 antikoerper
- Hintergrund
- The function of this gene remains unknown.
- Molekulargewicht
- 51 kDa (MW of target protein)
-