C19orf28 Antikörper (Middle Region)

Produktnummer ABIN635358

Dieser Anti-C19orf28-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von C19orf28 in WB und IHC. Geeignet für Human.

Kurzübersicht für C19orf28 Antikörper (Middle Region) (ABIN635358)

Target: C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C19orf28 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-C19orf28 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C19 ORF28 antibody was raised against the middle region of C19 rf28

Aufreinigung: Affinity purified

Immunogen: C19 ORF28 antibody was raised using the middle region of C19 rf28 corresponding to a region with amino acids VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF28 Blocking Peptide, (ABIN5612444), is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C19orf28

Target: C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))

Andere Bezeichnung: C19ORF28

Hintergrund: The function of this gene remains unknown.

Molekulargewicht: 51 kDa (MW of target protein)