Calsyntenin 1 (CLSTN1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635351
Antigen
Epitop
N-Term
16
11
5
3
2
1
Reaktivität
Human
65
22
21
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
66
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
3
3
3
3
3
3
3
3
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
42
26
13
8
5
2
1
1
Optionen
Immunogen Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI
Spezifität Calsyntenin 1 antibody was raised against the N terminal of CLSTN1
Reinigung Affinity purified
Antigen
Andere Bezeichnung Calsyntenin 1 (CLSTN1 Antibody Abstract)
Hintergrund CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.
Molekulargewicht 110 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Calsyntenin 1 Blocking Peptide, catalog no. 33R-4599, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Calsyntenin 1 (CLSTN1) (N-Term) antibody (ABIN635351) Calsyntenin 1 antibody used at 1 ug/ml to detect target protein.