Calsyntenin 1 Antikörper (N-Term)

Produktnummer ABIN635351

Produktdetails anti-Calsyntenin 1 Antikörper

Target: Calsyntenin 1 (CLSTN1)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Calsyntenin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Calsyntenin 1 antibody was raised against the N terminal of CLSTN1

Aufreinigung: Affinity purified

Immunogen: Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calsyntenin 1 Blocking Peptide, catalog no. 33R-4599, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Calsyntenin 1

Target: Calsyntenin 1 (CLSTN1)

Andere Bezeichnung: Calsyntenin 1 (CLSTN1 Produkte)

Synonyme: CALSYNTENIN-1 antikoerper, fm67g03 antikoerper, wu:fk52g02 antikoerper, wu:fm67g03 antikoerper, zgc:153744 antikoerper, zgc:56528 antikoerper, clstn1 antikoerper, 1810034E21Rik antikoerper, Cst-1 antikoerper, Cstn1 antikoerper, ALC-ALPHA antikoerper, CDHR12 antikoerper, CSTN1 antikoerper, PIK3CD antikoerper, XB31alpha antikoerper, alcalpha1 antikoerper, alcalpha2 antikoerper, calsyntenin 1 antikoerper, calsyntenin 3 antikoerper, beta-catenin-interacting protein 1 antikoerper, calsyntenin-1 antikoerper, CLSTN1 antikoerper, clstn1 antikoerper, clstn3 antikoerper, LOC100356725 antikoerper, LOC100435584 antikoerper, Clstn1 antikoerper, LOC479600 antikoerper

Hintergrund: CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.

Molekulargewicht: 110 kDa (MW of target protein)