SLC4A2 Antikörper (Solute Carrier Family 4, Anion Exchanger, Member 2 (erythrocyte Membrane Protein Band 3-Like 1)) (N-Term)

Details for Product anti-SLC4A2 Antibody No. ABIN635346
Antigen
Epitop
N-Term
12
3
1
1
Reaktivität
Human
44
14
7
3
3
3
2
2
2
2
1
1
1
Wirt
Kaninchen
48
Klonalität
Polyklonal
Konjugat
Dieser SLC4A2 Antikörper ist unkonjugiert
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
17
13
11
8
7
1
Optionen
Immunogen SLC4 A2 antibody was raised using the N terminal of SLC4 2 corresponding to a region with amino acids MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI
Spezifität SLC4 A2 antibody was raised against the N terminal of SLC4 2
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC4A2 (SLC4A2 Antibody Abstract)
Hintergrund SLC4A2 is a plasma membrane anion exchange protein of wide distribution.
Molekulargewicht 137 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC4A2 Blocking Peptide, catalog no. 33R-6496, is also available for use as a blocking control in assays to test for specificity of this SLC4A2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 4, Anion Exchanger, Member 2 (erythrocyte Membrane Protein Band 3-Like 1) (SLC4A2) (N-Term) antibody (ABIN635346) SLC4A2 antibody used at 1 ug/ml to detect target protein.