SLC4A2 Antikörper (N-Term)
-
- Target Alle SLC4A2 Antikörper anzeigen
- SLC4A2 (Solute Carrier Family 4, Anion Exchanger, Member 2 (erythrocyte Membrane Protein Band 3-Like 1) (SLC4A2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC4A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC4 A2 antibody was raised against the N terminal of SLC4 2
- Aufreinigung
- Affinity purified
- Immunogen
- SLC4 A2 antibody was raised using the N terminal of SLC4 2 corresponding to a region with amino acids MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI
- Top Product
- Discover our top product SLC4A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC4A2 Blocking Peptide, catalog no. 33R-6496, is also available for use as a blocking control in assays to test for specificity of this SLC4A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC4A2 (Solute Carrier Family 4, Anion Exchanger, Member 2 (erythrocyte Membrane Protein Band 3-Like 1) (SLC4A2))
- Andere Bezeichnung
- SLC4A2 (SLC4A2 Produkte)
- Synonyme
- AE2 antikoerper, BND3L antikoerper, EPB3L1 antikoerper, HKB3 antikoerper, NBND3 antikoerper, SLC4A2 antikoerper, B3RP antikoerper, Ae2 antikoerper, Aep2 antikoerper, AE 2 antikoerper, Anion exchanger 2 antikoerper, solute carrier family 4 member 2 antikoerper, anion exchange protein 2 antikoerper, solute carrier family 4 (anion exchanger), member 2 antikoerper, SLC4A2 antikoerper, LOC100599599 antikoerper, Slc4a2 antikoerper
- Hintergrund
- SLC4A2 is a plasma membrane anion exchange protein of wide distribution.
- Molekulargewicht
- 137 kDa (MW of target protein)
-