ENPP2 Antikörper (N-Term)

Produktnummer ABIN635340

Produktdetails anti-ENPP2 Antikörper

Target: ENPP2 (Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ENPP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ENPP2 antibody was raised against the N terminal of ENPP2

Aufreinigung: Affinity purified

Immunogen: ENPP2 antibody was raised using the N terminal of ENPP2 corresponding to a region with amino acids YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ENPP2 Blocking Peptide, catalog no. 33R-10264, is also available for use as a blocking control in assays to test for specificity of this ENPP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENPP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ENPP2

Target: ENPP2 (Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2))

Andere Bezeichnung: ENPP2 (ENPP2 Produkte)

Hintergrund: The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas.

Molekulargewicht: 95 kDa (MW of target protein)