AADACL4 Antikörper (Middle Region)
-
- Target Alle AADACL4 Produkte
- AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AADACL4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AADACL4 antibody was raised against the middle region of AADACL4
- Aufreinigung
- Affinity purified
- Immunogen
- AADACL4 antibody was raised using the middle region of AADACL4 corresponding to a region with amino acids IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AADACL4 Blocking Peptide, catalog no. 33R-4128, is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADACL4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))
- Andere Bezeichnung
- AADACL4 (AADACL4 Produkte)
- Synonyme
- RGD1565761 antikoerper, OTTMUSG00000010747 antikoerper, Aadacl4 antikoerper, arylacetamide deacetylase like 4 antikoerper, arylacetamide deacetylase-like 4 S homeolog antikoerper, arylacetamide deacetylase-like 4 antikoerper, arylacetamide deacetylase-like 4-like 3 antikoerper, AADACL4 antikoerper, aadacl4.S antikoerper, aadacl4 antikoerper, Aadacl4 antikoerper, AADACL4L3 antikoerper, LOC100218769 antikoerper, LOC100713568 antikoerper
- Hintergrund
- The function of AADAC protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 46 kDa (MW of target protein)
-