AADACL4 Antikörper (Middle Region)

Produktnummer ABIN635339

Produktdetails anti-AADACL4 Antikörper

Target: AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AADACL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AADACL4 antibody was raised against the middle region of AADACL4

Aufreinigung: Affinity purified

Immunogen: AADACL4 antibody was raised using the middle region of AADACL4 corresponding to a region with amino acids IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AADACL4 Blocking Peptide, catalog no. 33R-4128, is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADACL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AADACL4

Target: AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))

Andere Bezeichnung: AADACL4 (AADACL4 Produkte)

Synonyme: RGD1565761 antikoerper, OTTMUSG00000010747 antikoerper, Aadacl4 antikoerper, arylacetamide deacetylase like 4 antikoerper, arylacetamide deacetylase-like 4 S homeolog antikoerper, arylacetamide deacetylase-like 4 antikoerper, arylacetamide deacetylase-like 4-like 3 antikoerper, AADACL4 antikoerper, aadacl4.S antikoerper, aadacl4 antikoerper, Aadacl4 antikoerper, AADACL4L3 antikoerper, LOC100218769 antikoerper, LOC100713568 antikoerper

Hintergrund: The function of AADAC protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 46 kDa (MW of target protein)