AADACL4 Antikörper (Arylacetamide Deacetylase-Like 4) (N-Term)

Details for Product anti-AADACL4 Antibody No. ABIN635244
Dieser AADACL4 Antikörper ist unkonjugiert
Western Blotting (WB)
Immunogen AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG
Spezifität AADACL4 antibody was raised against the N terminal of AADACL4
Reinigung Affinity purified
Andere Bezeichnung AADACL4
Hintergrund The function of AADAC protein is not widely studied, and is yet to be elucidated fully.
Molekulargewicht 46 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

AADACL4 Blocking Peptide, catalog no. 33R-2935, is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADACL4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Arylacetamide Deacetylase-Like 4 (AADACL4) (N-Term) antibody (ABIN635244) AADACL4 antibody used at 1 ug/ml to detect target protein.