Lamin B Receptor Antikörper (Middle Region)

Produktnummer ABIN635330

Der Kaninchen Polyklonal Anti-Lamin B Receptor-Antikörper wurde für WB validiert. Er ist geeignet, Lamin B Receptor in Proben von Human zu detektieren.

Kurzübersicht für Lamin B Receptor Antikörper (Middle Region) (ABIN635330)

Target: Lamin B Receptor (LBR)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Lamin B Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Lamin B Receptor Antikörper

Bindungsspezifität: Middle Region

Spezifität: Lamin B Receptor antibody was raised against the middle region of LBR

Aufreinigung: Affinity purified

Immunogen: Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lamin B Receptor Blocking Peptide, (ABIN938550), is also available for use as a blocking control in assays to test for specificity of this Lamin B Receptor antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Lamin B Receptor

Target: Lamin B Receptor (LBR)

Andere Bezeichnung: Lamin B Receptor

Hintergrund: The protein encoded by this gene belongs to the ERG4/ERG24 family. It is localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Molekulargewicht: 71 kDa (MW of target protein)