B4GALNT1 Antikörper (Middle Region)

Produktnummer ABIN635329

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch B4GALNT1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für B4GALNT1 Antikörper (Middle Region) (ABIN635329)

Target: B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B4GALNT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-B4GALNT1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: B4 GALNT1 antibody was raised against the middle region of B4 ALNT1

Aufreinigung: Affinity purified

Immunogen: B4 GALNT1 antibody was raised using the middle region of B4 ALNT1 corresponding to a region with amino acids GLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

B4GALNT1 Blocking Peptide, (ABIN938781), is also available for use as a blocking control in assays to test for specificity of this B4GALNT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B4GALNT1

Target: B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))

Andere Bezeichnung: B4GALNT1

Hintergrund: GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.

Molekulargewicht: 59 kDa (MW of target protein)