C19orf28 Antikörper (N-Term)

Produktnummer ABIN635321

Der Kaninchen-Polyklonal Anti-C19orf28-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von C19orf28 in Proben aus Human. }

Kurzübersicht für C19orf28 Antikörper (N-Term) (ABIN635321)

Target: C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C19orf28 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C19orf28 Antikörper

Bindungsspezifität: N-Term

Spezifität: C19 ORF28 antibody was raised against the N terminal Of C19 rf28

Aufreinigung: Affinity purified

Immunogen: C19 ORF28 antibody was raised using the N terminal Of C19 rf28 corresponding to a region with amino acids MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF28 Blocking Peptide, (ABIN5612443), is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C19orf28

Target: C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))

Andere Bezeichnung: C19ORF28

Hintergrund: The C19ORF28 protein may be involved in transmembrane transport.

Molekulargewicht: 59 kDa (MW of target protein)