ABCB1 Antikörper

Produktnummer ABIN635318

Produktdetails anti-ABCB1 Antikörper

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ABCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCB1 Blocking Peptide, catalog no. 33R-1285, is also available for use as a blocking control in assays to test for specificity of this ABCB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCB1

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Andere Bezeichnung: ABCB1 (ABCB1 Produkte)

Synonyme: ABC20 antikoerper, CD243 antikoerper, CLCS antikoerper, GP170 antikoerper, MDR1 antikoerper, P-GP antikoerper, PGY1 antikoerper, Abcb1 antikoerper, Mdr1a antikoerper, p-gp antikoerper, xemdr antikoerper, Mdr1 antikoerper, Mdr1b antikoerper, Pgy-1 antikoerper, Pgy1 antikoerper, mdr antikoerper, ABCB1 antikoerper, PGP1 antikoerper, ATP binding cassette subfamily B member 1 antikoerper, ATP binding cassette subfamily B member 1A antikoerper, ATP binding cassette subfamily B member 1 L homeolog antikoerper, ATP-binding cassette, sub-family B (MDR/TAP), member 1B antikoerper, ABCB1 antikoerper, Abcb1a antikoerper, abcb1.L antikoerper, Abcb1b antikoerper, Abcb1 antikoerper

Hintergrund: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Molekulargewicht: 141 kDa (MW of target protein)