ABCB1 Antikörper (Middle Region)
-
- Target Alle ABCB1 Antikörper anzeigen
- ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
-
Bindungsspezifität
- AA 621-650, Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCB1 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human,Mouse,Rat.
- Sequenz
- IYFKLVTMQT AGNEVELENA ADESKSEIDA
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human,Mouse,Rat.
Gene Name: ATP-binding cassette, sub-family B (MDR/TAP), member 1
Protein Name: Multidrug resistance protein 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
- Isotyp
- IgG
-
-
- Applikationshinweise
-
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
IHC-F: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by ABIN921231 in IHC(P) and IHC(F).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal, 0.05 mg Sodium azide.
- Konservierungsmittel
- Thimerosal (Merthiolate), Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." in: Scientific reports, Vol. 6, pp. 26722, (2018) (PubMed).
: "Piwil2 is reactivated by HPV oncoproteins and initiates cell reprogramming via epigenetic regulation during cervical cancer tumorigenesis." in: Oncotarget, Vol. 7, Issue 40, pp. 64575-64588, (2018) (PubMed).
: "Acetazolamide Suppresses Multi-Drug Resistance-Related Protein 1 and P-Glycoprotein Expression by Inhibiting Aquaporins Expression in a Mesial Temporal Epilepsy Rat Model." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 23, pp. 5818-5825, (2018) (PubMed).
: "The natural compound GL22, isolated from Ganoderma mushrooms, suppresses tumor growth by altering lipid metabolism and triggering cell death." in: Cell death & disease, Vol. 9, Issue 6, pp. 689, (2018) (PubMed).
: "P-glycoprotein Mediates Postoperative Peritoneal Adhesion Formation by Enhancing Phosphorylation of the Chloride Channel-3." in: Theranostics, Vol. 6, Issue 2, pp. 204-18, (2017) (PubMed).
: "TALENs-directed knockout of the full-length transcription factor Nrf1α that represses malignant behaviour of human hepatocellular carcinoma (HepG2) cells." in: Scientific reports, Vol. 6, pp. 23775, (2017) (PubMed).
: "Metronomic chemotherapy remodel cancer-associated fibroblasts to decrease chemoresistance of gastric cancer in nude mice." in: Oncology letters, Vol. 14, Issue 6, pp. 7903-7909, (2017) (PubMed).
: "MDM4 overexpressed in acute myeloid leukemia patients with complex karyotype and wild-type TP53." in: PLoS ONE, Vol. 9, Issue 11, pp. e113088, (2016) (PubMed).
: "Expression of TP53, BCL-2, and VEGFA Genes in Esophagus Carcinoma and its Biological Significance." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 21, pp. 3016-22, (2016) (PubMed).
: "HOXB1 Is a Tumor Suppressor Gene Regulated by miR-3175 in Glioma." in: PLoS ONE, Vol. 10, Issue 11, pp. e0142387, (2016) (PubMed).
: "Effects of human umbilical cord mesenchymal stem cell transplantation combined with minimally invasive hematoma aspiration on intracerebral hemorrhage in rats." in: American journal of translational research, Vol. 7, Issue 11, pp. 2176-86, (2016) (PubMed).
: "The molecular mechanism of G2M cell cycle arrest induced by AFB1 in the jejunum." in: Oncotarget, Vol. 7, Issue 24, pp. 35592-35606, (2016) (PubMed).
: "Autophagy may occur at an early stage of cholangiocarcinogenesis via biliary intraepithelial neoplasia." in: Human pathology, Vol. 46, Issue 2, pp. 202-9, (2015) (PubMed).
: "Silencing of CXCR4 sensitizes triple-negative breast cancer cells to cisplatin." in: Oncotarget, Vol. 6, Issue 2, pp. 1020-30, (2015) (PubMed).
: "Lactotransferrin expression is downregulated and affects the mitogen-activated protein kinase pathway in gastric cancer." in: Oncology letters, Vol. 9, Issue 5, pp. 2409-2413, (2015) (PubMed).
: "Dietary NiCl₂ causes G₂/M cell cycle arrest in the broiler's kidney." in: Oncotarget, Vol. 6, Issue 34, pp. 35964-77, (2015) (PubMed).
: "c-Ski activates cancer-associated fibroblasts to regulate breast cancer cell invasion." in: Molecular oncology, Vol. 7, Issue 6, pp. 1116-28, (2014) (PubMed).
: "Proteomics analysis of normal and senescent NG108-15 cells: GRP78 plays a negative role in cisplatin-induced senescence in the NG108-15 cell line." in: PLoS ONE, Vol. 9, Issue 3, pp. e90114, (2014) (PubMed).
: "Effect of ligustilide on Ang II-induced hypertrophy in cardiomyocytes and the potential mechanisms." in: Experimental and therapeutic medicine, Vol. 8, Issue 1, pp. 169-174, (2014) (PubMed).
: "Anti-tumor effect of cactus polysaccharides on lung squamous carcinoma cells (SK-MES-1)." in: African journal of traditional, complementary, and alternative medicines : AJTCAM / African Networks on Ethnomedicines, Vol. 11, Issue 5, pp. 99-104, (2014) (PubMed).
: "
-
A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." in: Scientific reports, Vol. 6, pp. 26722, (2018) (PubMed).
-
- Target
- ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
- Andere Bezeichnung
- ABCB1 (ABCB1 Produkte)
- Hintergrund
-
P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.
Synonyms: ABC20 antibody|ABCB1 antibody|ATP binding cassette, sub family B (MDR/TAP), member 1 antibody|ATP-binding cassette sub-family B member 1 antibody|CD243 antibody|CLCS antibody|Colchicin sensitivity antibody|Doxorubicin resistance antibody|GP170 antibody|MDR1 antibody|MDR1_HUMAN antibody|Multidrug resistance 1 antibody|Multidrug resistance protein 1 antibody|P glycoprotein 1 antibody|P gp antibody|P-glycoprotein 1 antibody|PGY1 antibody - Gen-ID
- 5243
- UniProt
- P08183
-