PLGRKT Antikörper (Middle Region)

Produktnummer ABIN635312

Der Kaninchen Polyklonal anti-PLGRKT Antikörper wird verwendet zum Nachweis von PLGRKT in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für PLGRKT Antikörper (Middle Region) (ABIN635312)

Target: PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLGRKT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PLGRKT Antikörper

Bindungsspezifität: Middle Region

Spezifität: C9 ORF46 antibody was raised against the middle region of C9 rf46

Aufreinigung: Affinity purified

Immunogen: C9 ORF46 antibody was raised using the middle region of C9 rf46 corresponding to a region with amino acids GTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C9ORF46 Blocking Peptide, (ABIN938997), is also available for use as a blocking control in assays to test for specificity of this C9ORF46 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF46 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLGRKT

Target: PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))

Andere Bezeichnung: C9ORF46

Hintergrund: The function of C9orf46 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 17 kDa (MW of target protein)