OSBPL8 Antikörper (Middle Region)

Produktnummer ABIN635299

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch OSBPL8 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für OSBPL8 Antikörper (Middle Region) (ABIN635299)

Target: OSBPL8 (Oxysterol Binding Protein-Like 8 (OSBPL8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OSBPL8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OSBPL8 Antikörper

Bindungsspezifität: Middle Region

Spezifität: OSBPL8 antibody was raised against the middle region of OSBPL8

Aufreinigung: Affinity purified

Immunogen: OSBPL8 antibody was raised using the middle region of OSBPL8 corresponding to a region with amino acids YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OSBPL8 Blocking Peptide, (ABIN936229), is also available for use as a blocking control in assays to test for specificity of this OSBPL8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OSBPL8

Target: OSBPL8 (Oxysterol Binding Protein-Like 8 (OSBPL8))

Andere Bezeichnung: OSBPL8

Hintergrund: OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.

Molekulargewicht: 97 kDa (MW of target protein)