OSBPL8 Antikörper (N-Term)

Produktnummer ABIN635298

Produktdetails anti-OSBPL8 Antikörper

Target: OSBPL8 (Oxysterol Binding Protein-Like 8 (OSBPL8))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OSBPL8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OSBPL8 antibody was raised against the N terminal of OSBPL8

Aufreinigung: Affinity purified

Immunogen: OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OSBPL8 Blocking Peptide, catalog no. 33R-8722, is also available for use as a blocking control in assays to test for specificity of this OSBPL8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OSBPL8

Target: OSBPL8 (Oxysterol Binding Protein-Like 8 (OSBPL8))

Andere Bezeichnung: OSBPL8 (OSBPL8 Produkte)

Synonyme: RGD1561474 antikoerper, DKFZp469P0923 antikoerper, MST120 antikoerper, MSTP120 antikoerper, ORP8 antikoerper, OSBP10 antikoerper, AA536976 antikoerper, AA536995 antikoerper, C730029P18Rik antikoerper, D330025H14Rik antikoerper, ORP-8 antikoerper, oxysterol binding protein-like 8 antikoerper, oxysterol binding protein like 8 antikoerper, oxysterol binding protein like 8 L homeolog antikoerper, oxysterol-binding protein-related protein 8 antikoerper, Osbpl8 antikoerper, OSBPL8 antikoerper, osbpl8.L antikoerper, osbpl8 antikoerper, LOC100175952 antikoerper

Hintergrund: OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.

Molekulargewicht: 97 kDa (MW of target protein)