ATP1B1 Antikörper (ATPase, Na+/K+ Transporting, beta 1 Polypeptide) (N-Term)

Details for Product anti-ATP1B1 Antibody No. ABIN635297
Antigen
Epitop
N-Term
14
9
7
7
4
4
4
2
2
1
1
1
1
1
1
Reaktivität
Human
78
46
42
9
6
6
5
5
4
4
3
3
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Wirt
Kaninchen
81
7
4
1
Klonalität
Polyklonal
Konjugat
Dieser ATP1B1 Antikörper ist unkonjugiert
7
5
5
3
3
3
2
2
2
2
2
2
Applikation
Western Blotting (WB)
76
47
44
8
3
3
3
3
2
2
1
1
1
1
Optionen
Immunogen ATP1 B1 antibody was raised using the N terminal of ATP1 1 corresponding to a region with amino acids RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD
Spezifität ATP1 B1 antibody was raised against the N terminal of ATP1 1
Reinigung Affinity purified
Antigen
Andere Bezeichnung ATP1B1 (ATP1B1 Antibody Abstract)
Hintergrund ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases.
Molekulargewicht 35 kDa (MW of target protein)
Pathways Thyroid Hormone Synthesis, Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interaktom
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ATP1B1 Blocking Peptide, catalog no. 33R-8238, is also available for use as a blocking control in assays to test for specificity of this ATP1B1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1) (N-Term) antibody (ABIN635297) ATP1B1 antibody used at 1 ug/ml to detect target protein.