ATP1B1 Antikörper (N-Term)

Produktnummer ABIN635297

Produktdetails anti-ATP1B1 Antikörper

Target: ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP1B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP1 B1 antibody was raised against the N terminal of ATP1 1

Aufreinigung: Affinity purified

Immunogen: ATP1 B1 antibody was raised using the N terminal of ATP1 1 corresponding to a region with amino acids RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP1B1 Blocking Peptide, catalog no. 33R-8238, is also available for use as a blocking control in assays to test for specificity of this ATP1B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP1B1

Target: ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))

Andere Bezeichnung: ATP1B1 (ATP1B1 Produkte)

Synonyme: ATP1B antikoerper, Atp4b antikoerper, Atpb antikoerper, Atpb-1 antikoerper, NKbeta1 antikoerper, ATPBS antikoerper, atp1b1 antikoerper, atp1b1a antikoerper, cb710 antikoerper, ATPase Na+/K+ transporting subunit beta 1 antikoerper, ATPase, Na+/K+ transporting, beta 1 polypeptide antikoerper, ATPase beta chain antikoerper, ATP synthase CF1 beta subunit antikoerper, ATPase Na+/K+ transporting subunit beta 1 S homeolog antikoerper, ATPase, Na+/K+ transporting, beta 1b polypeptide antikoerper, ATP1B1 antikoerper, Atp1b1 antikoerper, atpB antikoerper, atp1b1.S antikoerper, atp1b1b antikoerper

Hintergrund: ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interaktom