ABCA5 Antikörper

Produktnummer ABIN635291

Der Kaninchen Polyklonal Anti-ABCA5-Antikörper wurde für WB validiert. Er ist geeignet, ABCA5 in Proben von Human zu detektieren.

Kurzübersicht für ABCA5 Antikörper (ABIN635291)

Target: ABCA5 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ABCA5 Antikörper

Aufreinigung: Affinity purified

Immunogen: ABCA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCA5 Blocking Peptide, (ABIN939145), is also available for use as a blocking control in assays to test for specificity of this ABCA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCA5

Target: ABCA5 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5))

Andere Bezeichnung: ABCA5

Hintergrund: The membrane-associated protein ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). ABCA5 is a member of the ABC1 subfamily.

Molekulargewicht: 186 kDa (MW of target protein)