ERP29 Antikörper (N-Term)

Produktnummer ABIN635286

Produktdetails anti-ERP29 Antikörper

Target: ERP29 (Endoplasmic Reticulum Protein 29 (ERP29))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERP29 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ERP29 antibody was raised against the N terminal of ERP29

Aufreinigung: Affinity purified

Immunogen: ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERP29 Blocking Peptide, catalog no. 33R-5588, is also available for use as a blocking control in assays to test for specificity of this ERP29 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERP29 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERP29

Target: ERP29 (Endoplasmic Reticulum Protein 29 (ERP29))

Andere Bezeichnung: ERP29 (ERP29 Produkte)

Synonyme: C12orf8 antikoerper, ERp28 antikoerper, ERp31 antikoerper, PDI-DB antikoerper, PDIA9 antikoerper, 1200015M03Rik antikoerper, 2810446M09Rik antikoerper, AW209030 antikoerper, Erp28 antikoerper, Erp31 antikoerper, PDI-Db antikoerper, endoplasmic reticulum protein 29 antikoerper, ERP29 antikoerper, Erp29 antikoerper

Hintergrund: This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.

Molekulargewicht: 26 kDa (MW of target protein)