ERP29 Antikörper (N-Term)
-
- Target Alle ERP29 Antikörper anzeigen
- ERP29 (Endoplasmic Reticulum Protein 29 (ERP29))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERP29 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ERP29 antibody was raised against the N terminal of ERP29
- Aufreinigung
- Affinity purified
- Immunogen
- ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI
- Top Product
- Discover our top product ERP29 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ERP29 Blocking Peptide, catalog no. 33R-5588, is also available for use as a blocking control in assays to test for specificity of this ERP29 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERP29 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERP29 (Endoplasmic Reticulum Protein 29 (ERP29))
- Andere Bezeichnung
- ERP29 (ERP29 Produkte)
- Hintergrund
- This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Molekulargewicht
- 26 kDa (MW of target protein)
-