ABCG5 Antikörper

Produktnummer ABIN635285

Der Kaninchen Polyklonal anti-ABCG5 Antikörper wird verwendet zum Nachweis von ABCG5 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für ABCG5 Antikörper (ABIN635285)

Target: ABCG5 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCG5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ABCG5 Antikörper

Aufreinigung: Affinity purified

Immunogen: ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCG5 Blocking Peptide, (ABIN937092), is also available for use as a blocking control in assays to test for specificity of this ABCG5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCG5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCG5

Target: ABCG5 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5))

Andere Bezeichnung: ABCG5

Hintergrund: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily.

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: Lipid Metabolism