USP48 Antikörper (C-Term)
Kurzübersicht für USP48 Antikörper (C-Term) (ABIN635246)
Target
Alle USP48 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- USP48 antibody was raised against the C terminal of USP48
-
Aufreinigung
- Affinity purified
-
Immunogen
- USP48 antibody was raised using the C terminal of USP48 corresponding to a region with amino acids PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
USP48 Blocking Peptide, (ABIN5616939), is also available for use as a blocking control in assays to test for specificity of this USP48 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP48 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- USP48 (Ubiquitin Specific Peptidase 48 (USP48))
-
Andere Bezeichnung
- USP48
-
Hintergrund
- USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.
-
Molekulargewicht
- 70 kDa (MW of target protein)
Target
-