Vip Antikörper (Middle Region)

Produktnummer ABIN635234

Produktdetails anti-Vip Antikörper

Target: Vip (Vasoactive Intestinal Peptide (Vip))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Vip Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VIP antibody was raised against the middle region of VIP

Aufreinigung: Affinity purified

Immunogen: VIP antibody was raised using the middle region of VIP corresponding to a region with amino acids VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VIP Blocking Peptide, catalog no. 33R-9742, is also available for use as a blocking control in assays to test for specificity of this VIP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Vip

Target: Vip (Vasoactive Intestinal Peptide (Vip))

Andere Bezeichnung: VIP (Vip Produkte)

Hintergrund: The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Molekulargewicht: 3 kDa (MW of target protein)

Pathways: Hormone Activity, cAMP Metabolic Process