Vip Antikörper (Middle Region)
-
- Target Alle Vip Antikörper anzeigen
- Vip (Vasoactive Intestinal Peptide (Vip))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Vip Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- VIP antibody was raised against the middle region of VIP
- Aufreinigung
- Affinity purified
- Immunogen
- VIP antibody was raised using the middle region of VIP corresponding to a region with amino acids VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE
- Top Product
- Discover our top product Vip Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VIP Blocking Peptide, catalog no. 33R-9742, is also available for use as a blocking control in assays to test for specificity of this VIP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Vip (Vasoactive Intestinal Peptide (Vip))
- Andere Bezeichnung
- VIP (Vip Produkte)
- Synonyme
- PHM27 antikoerper, vip1 antikoerper, zgc:171463 antikoerper, VIP antikoerper, vip-A antikoerper, PHI antikoerper, vasoactive intestinal peptide antikoerper, vasoactive intestinal peptide L homeolog antikoerper, vasoactive intestinal polypeptide antikoerper, VIP antikoerper, Vip antikoerper, vip antikoerper, vip.L antikoerper
- Hintergrund
- The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
- Molekulargewicht
- 3 kDa (MW of target protein)
- Pathways
- Hormone Activity, cAMP Metabolic Process
-