Vasoactive Intestinal Peptide (Vip) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN635234
Antigen
Epitop
Middle Region
16
13
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
Reaktivität
Human
115
54
41
20
8
8
7
6
6
5
4
4
3
2
1
Wirt
Kaninchen
105
21
6
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
65
65
38
36
17
13
11
10
6
2
2
2
1
1
Optionen
Immunogen VIP antibody was raised using the middle region of VIP corresponding to a region with amino acids VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE
Spezifität VIP antibody was raised against the middle region of VIP
Reinigung Affinity purified
Antigen
Andere Bezeichnung VIP (Vip Antibody Abstract)
Hintergrund The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Molekulargewicht 3 kDa (MW of target protein)
Pathways Hormone Activity, cAMP Metabolic Process
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

VIP Blocking Peptide, catalog no. 33R-9742, is also available for use as a blocking control in assays to test for specificity of this VIP antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIP antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Vasoactive Intestinal Peptide (Vip) (Middle Region) antibody (ABIN635234) VIP antibody used at 1 ug/ml to detect target protein.