HGF Antikörper

Produktnummer ABIN635210

Der Kaninchen Polyklonal anti-HGF Antikörper wird verwendet zum Nachweis von HGF in Proben von Human, Ratte, Maus und Hund. Er wurde validiert für WB.

Kurzübersicht für HGF Antikörper (ABIN635210)

Target: HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HGF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HGF Antikörper

Aufreinigung: Affinity purified

Immunogen: HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HGF Blocking Peptide, (ABIN5614000), is also available for use as a blocking control in assays to test for specificity of this HGF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HGF

Target: HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))

Andere Bezeichnung: HGF

Hintergrund: Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration.

Molekulargewicht: 79 kDa (MW of target protein)

Pathways: RTK Signalweg, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Synaptic Membrane, Signaling of Hepatocyte Growth Factor Receptor