LPCAT1 Antikörper (Middle Region)

Produktnummer ABIN635206

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LPCAT1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für LPCAT1 Antikörper (Middle Region) (ABIN635206)

Target: LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LPCAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LPCAT1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LPCAT1 antibody was raised against the middle region of LPCAT1

Aufreinigung: Affinity purified

Immunogen: LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LPCAT1 Blocking Peptide, (ABIN5614555), is also available for use as a blocking control in assays to test for specificity of this LPCAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPCAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LPCAT1

Target: LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))

Andere Bezeichnung: LPCAT1

Hintergrund: Lysophosphatidylcholine (LPC) acyltransferase (LPCAT, EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis.

Molekulargewicht: 59 kDa (MW of target protein)