SLC41A1 Antikörper (N-Term)

Produktnummer ABIN635173

Produktdetails anti-SLC41A1 Antikörper

Target: SLC41A1 (Solute Carrier Family 41, Member 1 (SLC41A1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC41A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC41 A1 antibody was raised against the N terminal of SLC41 1

Aufreinigung: Affinity purified

Immunogen: SLC41 A1 antibody was raised using the N terminal of SLC41 1 corresponding to a region with amino acids TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC41A1 Blocking Peptide, catalog no. 33R-9280, is also available for use as a blocking control in assays to test for specificity of this SLC41A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC41A1

Target: SLC41A1 (Solute Carrier Family 41, Member 1 (SLC41A1))

Andere Bezeichnung: SLC41A1 (SLC41A1 Produkte)

Synonyme: fd54c09 antikoerper, wu:fd54c09 antikoerper, MgtE antikoerper, AI573938 antikoerper, B230315F01Rik antikoerper, solute carrier family 41 (magnesium transporter), member 1 antikoerper, solute carrier family 41 member 1 antikoerper, solute carrier family 41, member 1 antikoerper, slc41a1 antikoerper, SLC41A1 antikoerper, Slc41a1 antikoerper

Hintergrund: SLC41A1 belongs to the SLC41A transporter family. It acts as a magnesium transporter that is responsive to magnesium balance.

Molekulargewicht: 55 kDa (MW of target protein)