SLC41A1 Antikörper (N-Term)

Produktnummer ABIN635173

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SLC41A1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SLC41A1 Antikörper (N-Term) (ABIN635173)

Target: SLC41A1 (Solute Carrier Family 41, Member 1 (SLC41A1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC41A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC41A1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SLC41 A1 antibody was raised against the N terminal of SLC41 1

Aufreinigung: Affinity purified

Immunogen: SLC41 A1 antibody was raised using the N terminal of SLC41 1 corresponding to a region with amino acids TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC41A1 Blocking Peptide, (ABIN5616252), is also available for use as a blocking control in assays to test for specificity of this SLC41A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC41A1

Target: SLC41A1 (Solute Carrier Family 41, Member 1 (SLC41A1))

Andere Bezeichnung: SLC41A1

Hintergrund: SLC41A1 belongs to the SLC41A transporter family. It acts as a magnesium transporter that is responsive to magnesium balance.

Molekulargewicht: 55 kDa (MW of target protein)