LRRC26 Antikörper (Middle Region)
-
- Target Alle LRRC26 Antikörper anzeigen
- LRRC26 (Leucine Rich Repeat Containing 26 (LRRC26))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRRC26 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRRC26 antibody was raised against the middle region of Lrrc26
- Aufreinigung
- Affinity purified
- Immunogen
- LRRC26 antibody was raised using the middle region of Lrrc26 corresponding to a region with amino acids LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRRC26 Blocking Peptide, catalog no. 33R-5378, is also available for use as a blocking control in assays to test for specificity of this LRRC26 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC26 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC26 (Leucine Rich Repeat Containing 26 (LRRC26))
- Andere Bezeichnung
- LRRC26 (LRRC26 Produkte)
- Hintergrund
- LRRC26 is an auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha), required for the conversion of BK alpha channels from a high-voltage to a low-voltage activated channel type in non-excitable cells. These are characterized by negative membrane voltages and constant low levels of calcium.
- Molekulargewicht
- 37 kDa (MW of target protein)
-