CISD2 Antikörper (CDGSH Iron Sulfur Domain 2) (N-Term)

Details for Product anti-CISD2 Antibody No. ABIN635156
Antigen
Epitop
N-Term
4
4
2
1
1
1
Reaktivität
Human
32
15
15
2
2
2
2
2
1
1
1
Wirt
Kaninchen
32
1
Klonalität
Polyklonal
Konjugat
Dieser CISD2 Antikörper ist unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
29
18
13
9
4
2
1
1
Optionen
Immunogen CISD2 antibody was raised using the N terminal of CISD2 corresponding to a region with amino acids VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL
Spezifität CISD2 antibody was raised against the N terminal of CISD2
Reinigung Affinity purified
Antigen
Andere Bezeichnung CISD2 (CISD2 Antibody Abstract)
Hintergrund CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).
Molekulargewicht 15 kDa (MW of target protein)
Pathways Activation of Innate immune Response
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

CISD2 Blocking Peptide, catalog no. 33R-9652, is also available for use as a blocking control in assays to test for specificity of this CISD2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CISD2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-CDGSH Iron Sulfur Domain 2 (CISD2) (N-Term) antibody (ABIN635156) CISD2 antibody used at 1 ug/ml to detect target protein.