CISD2 Antikörper (N-Term)

Produktnummer ABIN635156

Der Kaninchen-Polyklonal Anti-CISD2-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von CISD2 in Proben aus Human. }

Kurzübersicht für CISD2 Antikörper (N-Term) (ABIN635156)

Target: CISD2 (CDGSH Iron Sulfur Domain 2 (CISD2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CISD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CISD2 Antikörper

Bindungsspezifität: N-Term

Spezifität: CISD2 antibody was raised against the N terminal of CISD2

Aufreinigung: Affinity purified

Immunogen: CISD2 antibody was raised using the N terminal of CISD2 corresponding to a region with amino acids VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CISD2 Blocking Peptide, (ABIN5612893), is also available for use as a blocking control in assays to test for specificity of this CISD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CISD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CISD2

Target: CISD2 (CDGSH Iron Sulfur Domain 2 (CISD2))

Andere Bezeichnung: CISD2

Hintergrund: CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: Activation of Innate immune Response