FMO3 Antikörper (Flavin Containing Monooxygenase 3) (N-Term)

Details for Product anti-FMO3 Antibody No. ABIN635154
Antigen
Epitop
N-Term
17
8
7
4
4
3
2
2
1
1
1
1
1
1
1
Reaktivität
Human
88
43
39
5
5
5
4
4
3
2
2
1
1
Wirt
Kaninchen
84
5
Klonalität
Polyklonal
Konjugat
Dieser FMO3 Antikörper ist unkonjugiert
5
4
4
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
68
28
17
13
11
4
3
1
1
1
Optionen
Immunogen FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG
Spezifität FMO3 antibody was raised against the N terminal of FMO3
Reinigung Affinity purified
Antigen
Andere Bezeichnung FMO3 (FMO3 Antibody Abstract)
Hintergrund FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.
Molekulargewicht 60 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FMO3 Blocking Peptide, catalog no. 33R-6042, is also available for use as a blocking control in assays to test for specificity of this FMO3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Flavin Containing Monooxygenase 3 (FMO3) (N-Term) antibody (ABIN635154) FMO3 antibody used at 1 ug/ml to detect target protein.