FMO3 Antikörper (N-Term)
-
- Target Alle FMO3 Antikörper anzeigen
- FMO3 (Flavin Containing Monooxygenase 3 (FMO3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FMO3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FMO3 antibody was raised against the N terminal of FMO3
- Aufreinigung
- Affinity purified
- Immunogen
- FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG
- Top Product
- Discover our top product FMO3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FMO3 Blocking Peptide, catalog no. 33R-6042, is also available for use as a blocking control in assays to test for specificity of this FMO3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FMO3 (Flavin Containing Monooxygenase 3 (FMO3))
- Andere Bezeichnung
- FMO3 (FMO3 Produkte)
- Hintergrund
- FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.
- Molekulargewicht
- 60 kDa (MW of target protein)
-