FMO3 Antikörper (N-Term)

Produktnummer ABIN635154

Dieses Anti-FMO3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FMO3 in WB. Geeignet für Human.

Kurzübersicht für FMO3 Antikörper (N-Term) (ABIN635154)

Target: FMO3 (Flavin Containing Monooxygenase 3 (FMO3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FMO3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FMO3 Antikörper

Bindungsspezifität: N-Term

Spezifität: FMO3 antibody was raised against the N terminal of FMO3

Aufreinigung: Affinity purified

Immunogen: FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FMO3 Blocking Peptide, (ABIN5613622), is also available for use as a blocking control in assays to test for specificity of this FMO3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FMO3

Target: FMO3 (Flavin Containing Monooxygenase 3 (FMO3))

Andere Bezeichnung: FMO3

Hintergrund: FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.

Molekulargewicht: 60 kDa (MW of target protein)