Anoctamin 10 Antikörper (C-Term)
-
- Target Alle Anoctamin 10 (ANO10) Antikörper anzeigen
- Anoctamin 10 (ANO10)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Anoctamin 10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM16 K antibody was raised against the C terminal of TMEM16
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM16 K antibody was raised using the C terminal of TMEM16 corresponding to a region with amino acids LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA
- Top Product
- Discover our top product ANO10 Primärantikörper
-
anti-Anoctamin 10 (ANO10) (C-Term) antibody
ANO10 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Zebrafisch (Danio rerio), Hund, Meerschweinchen, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-Anoctamin 10 (ANO10) (C-Term) antibodyANO10 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Zebrafisch (Danio rerio), Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Anoctamin 10 (ANO10) (AA 620-653) antibodyANO10 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB53590 unconjugated
anti-Anoctamin 10 (ANO10) (AA 1-392) antibodyANO10 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2B12-1A11 unconjugated
anti-Anoctamin 10 (ANO10) (AA 470-519) antibodyANO10 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Hund, Meerschweinchen, Pferd, Xenopus laevis, Schwein, Fledermaus, Hamster, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Anoctamin 10 (ANO10) antibodyANO10 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM16K Blocking Peptide, catalog no. 33R-5070, is also available for use as a blocking control in assays to test for specificity of this TMEM16K antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Anoctamin 10 (ANO10)
- Andere Bezeichnung
- TMEM16K (ANO10 Produkte)
- Synonyme
- TMEM16K antikoerper, ano10 antikoerper, zgc:114140 antikoerper, tmem16k antikoerper, SCAR10 antikoerper, AI604832 antikoerper, Tmem16k antikoerper, RGD1308260 antikoerper, anoctamin 10 antikoerper, anoctamin 10a antikoerper, transmembrane protein 16K antikoerper, anoctamin 10 L homeolog antikoerper, ANO10 antikoerper, ano10 antikoerper, ano10a antikoerper, MCYG_02694 antikoerper, MGYG_08424 antikoerper, ano10.L antikoerper, Ano10 antikoerper
- Hintergrund
- TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.
- Molekulargewicht
- 76 kDa (MW of target protein)
-
