Anoctamin 10 (ANO10) (C-Term) Antikörper

Details zu Produkt Nr. ABIN635146
Antigen
Epitop
C-Term
3
2
2
2
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
13
6
5
4
3
3
2
2
2
2
1
1
1
1
Wirt
Kaninchen
10
3
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
13
6
4
1
1
Optionen
Immunogen TMEM16 K antibody was raised using the C terminal of TMEM16 corresponding to a region with amino acids LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA
Spezifität TMEM16 K antibody was raised against the C terminal of TMEM16
Reinigung Affinity purified
Antigen
Andere Bezeichnung TMEM16K (ANO10 Antibody Abstract)
Hintergrund TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.
Molekulargewicht 76 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TMEM16K Blocking Peptide, catalog no. 33R-5070, is also available for use as a blocking control in assays to test for specificity of this TMEM16K antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Anoctamin 10 (ANO10) (C-Term) antibody (ABIN635146) TMEM16K antibody used at 1 ug/ml to detect target protein.