Anoctamin 10 Antikörper (C-Term)

Produktnummer ABIN635146

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Anoctamin 10 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für Anoctamin 10 Antikörper (C-Term) (ABIN635146)

Target: Anoctamin 10 (ANO10)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Anoctamin 10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Anoctamin 10 Antikörper

Bindungsspezifität: C-Term

Spezifität: TMEM16 K antibody was raised against the C terminal of TMEM16

Aufreinigung: Affinity purified

Immunogen: TMEM16 K antibody was raised using the C terminal of TMEM16 corresponding to a region with amino acids LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM16K Blocking Peptide, (ABIN940456), is also available for use as a blocking control in assays to test for specificity of this TMEM16K antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Anoctamin 10

Target: Anoctamin 10 (ANO10)

Andere Bezeichnung: TMEM16K

Hintergrund: TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.

Molekulargewicht: 76 kDa (MW of target protein)