EPO Antikörper (Middle Region)
-
- Target Alle EPO Antikörper anzeigen
- EPO (Erythropoietin (EPO))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EPO Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EPO antibody was raised against the middle region of EPO
- Aufreinigung
- Affinity purified
- Immunogen
- EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD
- Top Product
- Discover our top product EPO Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EPO Blocking Peptide, catalog no. 33R-4315, is also available for use as a blocking control in assays to test for specificity of this EPO antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPO antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EPO (Erythropoietin (EPO))
- Andere Bezeichnung
- EPO (EPO Produkte)
- Synonyme
- EPO antikoerper, EP antikoerper, MVCD2 antikoerper, erythropoietin antikoerper, erythropoietin S homeolog antikoerper, erythropoietin a antikoerper, EPO antikoerper, epo antikoerper, epo.S antikoerper, Epo antikoerper, epoa antikoerper
- Substanzklasse
- Hormone
- Hintergrund
- This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.
- Molekulargewicht
- 18 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Hormone Activity, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity
-