EPO Antikörper (Erythropoietin) (Middle Region)

Details for Product anti-EPO Antibody No. ABIN635113
Antigen
Epitop
Middle Region
40
17
17
15
13
11
8
8
8
5
5
4
4
3
3
3
3
2
2
2
1
1
1
1
1
Reaktivität
Human
298
57
46
7
6
5
4
4
4
2
2
2
2
1
1
1
1
Wirt
Kaninchen
187
151
4
2
1
1
Klonalität
Polyklonal
Konjugat
Dieser EPO Antikörper ist unkonjugiert
27
14
13
5
5
4
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
237
177
89
59
53
38
21
13
11
11
11
11
8
8
5
4
2
2
2
2
2
1
1
1
Optionen
Immunogen EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD
Spezifität EPO antibody was raised against the middle region of EPO
Reinigung Affinity purified
Antigen
Andere Bezeichnung EPO (EPO Antibody Abstract)
Substanzklasse Hormone
Hintergrund This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.
Molekulargewicht 18 kDa (MW of target protein)
Pathways JAK-STAT Signalweg, Hormone Activity, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

EPO Blocking Peptide, catalog no. 33R-4315, is also available for use as a blocking control in assays to test for specificity of this EPO antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPO antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Erythropoietin (EPO) (Middle Region) antibody (ABIN635113) EPO antibody used at 1 ug/ml to detect target protein.