EPO Antikörper (Middle Region)

Produktnummer ABIN635113

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch EPO in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für EPO Antikörper (Middle Region) (ABIN635113)

Target: EPO (Erythropoietin (EPO))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EPO Antikörper

Bindungsspezifität: Middle Region

Spezifität: EPO antibody was raised against the middle region of EPO

Aufreinigung: Affinity purified

Immunogen: EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPO Blocking Peptide, (ABIN939701), is also available for use as a blocking control in assays to test for specificity of this EPO antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPO antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPO

Target: EPO (Erythropoietin (EPO))

Andere Bezeichnung: EPO

Substanzklasse: Hormone

Hintergrund: This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.

Molekulargewicht: 18 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Hormone Activity, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity