TRPM2 Antikörper (N-Term)

Produktnummer ABIN635099

Produktdetails anti-TRPM2 Antikörper

Target: TRPM2 (Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRPM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRPM2 antibody was raised against the N terminal of TRPM2

Aufreinigung: Affinity purified

Immunogen: TRPM2 antibody was raised using the N terminal of TRPM2 corresponding to a region with amino acids VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRPM2 Blocking Peptide, catalog no. 33R-9418, is also available for use as a blocking control in assays to test for specificity of this TRPM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRPM2

Target: TRPM2 (Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2))

Andere Bezeichnung: TRPM2 (TRPM2 Produkte)

Synonyme: EREG1 antikoerper, KNP3 antikoerper, LTRPC2 antikoerper, NUDT9H antikoerper, NUDT9L1 antikoerper, TRPC7 antikoerper, Trpm2-predicted antikoerper, TRPM2 antikoerper, si:ch73-263b18.1 antikoerper, 9830168K16Rik antikoerper, C79133 antikoerper, Trp7 antikoerper, Trrp7 antikoerper, transient receptor potential cation channel subfamily M member 2 antikoerper, transient receptor potential cation channel, subfamily M, member 2 antikoerper, transient receptor potential cation channel subfamily C member 7 antikoerper, TRPM2 antikoerper, Trpm2 antikoerper, trpm2 antikoerper, TRPC7 antikoerper

Hintergrund: The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Molekulargewicht: 171 kDa (MW of target protein)