COQ2 Antikörper

Produktnummer ABIN635093

Produktdetails anti-COQ2 Antikörper

Target: COQ2 (Coenzyme Q2 Homolog, Prenyltransferase (COQ2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COQ2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: COQ2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COQ2 Blocking Peptide, catalog no. 33R-3061, is also available for use as a blocking control in assays to test for specificity of this COQ2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COQ2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COQ2

Target: COQ2 (Coenzyme Q2 Homolog, Prenyltransferase (COQ2))

Andere Bezeichnung: COQ2 (COQ2 Produkte)

Synonyme: CG9613 antikoerper, COQ2 antikoerper, Dmel\\CG9613 antikoerper, coq2 antikoerper, sbo antikoerper, CL640 antikoerper, COQ10D1 antikoerper, MSA1 antikoerper, RGD1306722 antikoerper, zgc:162600 antikoerper, 2310002F18Rik antikoerper, Coenzyme Q biosynthesis protein 2 antikoerper, coenzyme Q2, polyprenyltransferase antikoerper, coenzyme Q2 4-hydroxybenzoate polyprenyltransferase antikoerper, 4-hydroxybenzoate polyprenyltransferase, mitochondrial antikoerper, Coq2 antikoerper, COQ2 antikoerper, coq2 antikoerper, coq-2 antikoerper

Hintergrund: COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.

Molekulargewicht: 42 kDa (MW of target protein)