Dipeptidylpeptidase 10 (DPP10) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN635073
Antigen
Epitop
Middle Region
17
13
11
10
8
5
1
1
1
1
1
Reaktivität
Human
84
33
20
6
5
5
4
4
3
2
1
1
Wirt
Kaninchen
69
7
7
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
4
4
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
55
29
22
17
13
6
2
2
Optionen
Immunogen DPP10 antibody was raised using the middle region of DPP10 corresponding to a region with amino acids VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE
Spezifität DPP10 antibody was raised against the middle region of DPP10
Reinigung Affinity purified
Antigen
Andere Bezeichnung DPP10 (DPP10 Antibody Abstract)
Hintergrund DPP10 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma.
Molekulargewicht 90 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

DPP10 Blocking Peptide, catalog no. 33R-9716, is also available for use as a blocking control in assays to test for specificity of this DPP10 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP10 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Dipeptidylpeptidase 10 (DPP10) (Middle Region) antibody (ABIN635073) DPP10 antibody used at 1 ug/ml to detect target protein.