DPP10 Antikörper (Middle Region)

Produktnummer ABIN635073

Produktdetails anti-DPP10 Antikörper

Target: DPP10 (Dipeptidylpeptidase 10 (DPP10))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPP10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DPP10 antibody was raised against the middle region of DPP10

Aufreinigung: Affinity purified

Immunogen: DPP10 antibody was raised using the middle region of DPP10 corresponding to a region with amino acids VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPP10 Blocking Peptide, catalog no. 33R-9716, is also available for use as a blocking control in assays to test for specificity of this DPP10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPP10

Target: DPP10 (Dipeptidylpeptidase 10 (DPP10))

Andere Bezeichnung: DPP10 (DPP10 Produkte)

Synonyme: DPL2 antikoerper, DPPY antikoerper, DPRP3 antikoerper, DPP10 antikoerper, MGC84485 antikoerper, 6430601K09Rik antikoerper, DPP X antikoerper, Dprp3 antikoerper, dipeptidyl peptidase like 10 antikoerper, dipeptidyl-peptidase 10 (inactive) L homeolog antikoerper, dipeptidylpeptidase 10 antikoerper, DPP10 antikoerper, dpp10.L antikoerper, Dpp10 antikoerper

Hintergrund: DPP10 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma.

Molekulargewicht: 90 kDa (MW of target protein)