SLC25A32 Antikörper (Solute Carrier Family 25, Member 32) (N-Term)

Details for Product anti-SLC25A32 Antibody No. ABIN635067
Antigen
Epitop
N-Term
4
2
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus), Hund
10
7
6
5
4
4
4
3
3
2
2
2
2
2
1
1
Wirt
Kaninchen
10
Klonalität
Polyklonal
Konjugat
Dieser SLC25A32 Antikörper ist unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
7
5
Optionen
Immunogen SLC25 A32 antibody was raised using the N terminal of SLC25 32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT
Spezifität SLC25 A32 antibody was raised against the N terminal of SLC25 32
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC25A32 (SLC25A32 Antibody Abstract)
Hintergrund SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.
Molekulargewicht 35 kDa (MW of target protein)
Pathways Dicarboxylic Acid Transport
Applikations-hinweise WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC25A32 Blocking Peptide, catalog no. 33R-9795, is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 25, Member 32 (SLC25A32) (N-Term) antibody (ABIN635067) SLC25A32 antibody used at 0.25 ug/ml to detect target protein.