SLC25A32 Antikörper (Middle Region)

Produktnummer ABIN635047

Produktdetails anti-SLC25A32 Antikörper

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC25 A32 antibody was raised against the middle region of SLC25 32

Aufreinigung: Affinity purified

Immunogen: SLC25 A32 antibody was raised using the middle region of SLC25 32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A32 Blocking Peptide, catalog no. 33R-6857, is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A32

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Andere Bezeichnung: SLC25A32 (SLC25A32 Produkte)

Synonyme: fi40c12 antikoerper, mftc antikoerper, wu:fi40c12 antikoerper, zgc:55610 antikoerper, zgc:110786 antikoerper, RGD1565789 antikoerper, MFT antikoerper, MFTC antikoerper, 2610043O12Rik antikoerper, Mftc antikoerper, solute carrier family 25 (mitochondrial folate carrier), member 32a antikoerper, solute carrier family 25 (mitochondrial folate carrier), member 32b antikoerper, NAD transporter antikoerper, mitochondrial folate transporter/carrier antikoerper, solute carrier family 25 member 32 antikoerper, solute carrier family 25 (mitochondrial folate carrier), member 32 L homeolog antikoerper, solute carrier family 25, member 32 antikoerper, slc25a32a antikoerper, slc25a32b antikoerper, SJAG_04328 antikoerper, PAAG_07673 antikoerper, PAAG_03661 antikoerper, MCYG_01228 antikoerper, MGYG_01778 antikoerper, SLC25A32 antikoerper, Slc25a32 antikoerper, slc25a32.L antikoerper

Hintergrund: SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport